Keyword : transmission


Millimeter-Wave Scattering and Transmission of Misaligned Dual Metallic Grating Screens
Hyun Ho PARK Seungyoung AHN 
Publication:   
Publication Date: 2019/06/01
Vol. E102-B  No. 6 ; pp. 1180-1187
Type of Manuscript:  PAPER
Category: Antennas and Propagation
Keyword: 
electromagnetic scatteringtransmissionFourier transformdual metallic gratingsmode-matching technique
 Summary | Full Text:PDF(8.1MB)

Review of Space-Division Multiplexing Technologies in Optical Communications
Yoshinari AWAJI 
Publication:   
Publication Date: 2019/01/01
Vol. E102-B  No. 1 ; pp. 1-16
Type of Manuscript:  INVITED SURVEY PAPER
Category: Transmission Systems and Transmission Equipment for Communications
Keyword: 
capacity crunchmulti-core fiberfew-mode fibertransmissionamplifierswitching
 Summary | Full Text:PDF(5.3MB)

Low Optical Loss Connection for Photonic Crystal Slab Waveguides
Akiko GOMYO Jun USHIDA Masayuki SHIRANE Masatoshi TOKUSHIMA Hirohito YAMADA 
Publication:   IEICE TRANSACTIONS on Electronics
Publication Date: 2004/03/01
Vol. E87-C  No. 3 ; pp. 328-335
Type of Manuscript:  INVITED PAPER (Special Section on Photonic Crystals and Their Device Applications)
Category: 
Keyword: 
photonic crystal slabimmittance of EM Bloch wavesimpedanceadmittancereflectiontransmissiontrapezoidal interface structure
 Summary | Full Text:PDF(1.5MB)

All-Optical Signal Regenerators for Ultra-High Bit-Rate Transmission Systems
Patrick BRINDEL Bruno DANY Delphine ROUVILLAIN Bruno LAVIGNE Patricia GUERBER Elodie BALMEFREZOL Olivier LECLERC 
Publication:   IEICE TRANSACTIONS on Electronics
Publication Date: 2002/01/01
Vol. E85-C  No. 1 ; pp. 126-134
Type of Manuscript:  INVITED PAPER (Special Issue on Ultrafast Optical Signal Processing and Its Application)
Category: OTDM Transmission System, Optical Regeneration and Coding
Keyword: 
optical regenerationtransmissionsolitonnon-return to zero (NRZ)return-to-zero (RZ)
 Summary | Full Text:PDF(611.5KB)

Pre- and Post-Dispersion Compensation in Long-Haul WDM Transmission System
Takao NAITO Takafumi TERAHARA Naomasa SHIMOJOH Takashi YORITA Terumi CHIKAMA Masuo SUYAMA 
Publication:   IEICE TRANSACTIONS on Communications
Publication Date: 2000/07/25
Vol. E83-B  No. 7 ; pp. 1409-1416
Type of Manuscript:  PAPER
Category: Fiber-Optic Transmission
Keyword: 
EDFAdispersion compensationlong-haulWDMtransmission
 Summary | Full Text:PDF(915.3KB)

High Alumina Co-Doped Silica EDFA and Its Gain-Equalization in Long-Haul WDM Transmission System
Takao NAITO Naomasa SHIMOJOH Takafumi TERAHARA Toshiki TANAKA Terumi CHIKAMA Masuo SUYAMA 
Publication:   IEICE TRANSACTIONS on Communications
Publication Date: 2000/04/25
Vol. E83-B  No. 4 ; pp. 775-781
Type of Manuscript:  PAPER
Category: Fiber-Optic Transmission
Keyword: 
EDFAgain-equalizationlong-haulWDMtransmission
 Summary | Full Text:PDF(1.2MB)

Ultrafast Optical TDM Networking: Extension to the Wide Area
John D. MOORES Jeff KORN Katherine L. HALL Steven G. FINN Kristin A. RAUSCHENBACH 
Publication:   IEICE TRANSACTIONS on Electronics
Publication Date: 1999/02/25
Vol. E82-C  No. 2 ; pp. 157-169
Type of Manuscript:  INVITED PAPER (Joint Special Issue on Photonics in Switching: Systems and Devices)
Category: Photonic Networking
Keyword: 
optical networkoptical time division multiplexing (OTDM)wide area networktransmissionregenerationQoSbandwidthprotocolpacketscalablelong-haulexperimentnumerical simulation
 Summary | Full Text:PDF(1010.7KB)

Ultrafast Optical TDM Networking: Extension to the Wide Area
John D. MOORES Jeff KORN Katherine L. HALL Steven G. FINN Kristin A. RAUSCHENBACH 
Publication:   IEICE TRANSACTIONS on Communications
Publication Date: 1999/02/25
Vol. E82-B  No. 2 ; pp. 209-221
Type of Manuscript:  INVITED PAPER (Joint Special Issue on Photonics in Switching: Systems and Devices)
Category: Photonic Networking
Keyword: 
optical networkoptical time division multiplexing (OTDM)wide area networktransmissionregenerationQoSbandwidthprotocolpacketscalablelong-haulexperimentnumerical simulation
 Summary | Full Text:PDF(1MB)

Network Reflection and Transmission Coefficients for the Interconnection of Multi-Port Multi-Line Junction Networks
Iwata SAKAGAMI 
Publication:   IEICE TRANSACTIONS on Fundamentals of Electronics, Communications and Computer Sciences
Publication Date: 1996/03/25
Vol. E79-A  No. 3 ; pp. 297-303
Type of Manuscript:  Special Section PAPER (Special Section of Selected Papers from the 8th Karuizawa Workshop on Circuits and Systems)
Category: 
Keyword: 
interconnectionN-porttransmissiontransientmicrowave network
 Summary | Full Text:PDF(456.1KB)

Characterization of Inverted Slot Line for Travelling Wave Optical Modulator
Tsukasa YONEYAMA Tohru IWASAKI 
Publication:   IEICE TRANSACTIONS on Electronics
Publication Date: 1993/02/25
Vol. E76-C  No. 2 ; pp. 229-237
Type of Manuscript:  Special Section PAPER (Special Issue on Optical/Microwave Interaction Devices, Circuits and Systems)
Category: Optical/Microwave Devices
Keyword: 
optical modulatorinverted slot linespectral domain techniquemillimeter-wavetransmissionLiNbO3 substrate
 Summary | Full Text:PDF(649.6KB)