Keyword : millimeter-wave

Towards mmWave V2X in 5G and Beyond to Support Automated Driving
Publication Date: 2021/06/01
Vol. E104-B  No. 6 ; pp. 587-603
Type of Manuscript:  INVITED SURVEY PAPER
Category: Terrestrial Wireless Communication/Broadcasting Technologies
automated drivingcooperative perceptionV2XV2VIEEE802.11pLTE-V2Xmillimeter-wave5GIEEE802.11ad/bdNR-V2X
 Summary | Full Text:PDF

60GHz 180µW Power Consumption CMOS ASK Transmitter Using Combined On-Chip Resonator and Antenna
Publication Date: 2019/10/01
Vol. E102-C  No. 10 ; pp. 725-731
Type of Manuscript:  Special Section PAPER (Special Section on Microwave and Millimeter-Wave Technologies)
ultra-low powerASK transmittermillimeter-waveon-chip antennacombined resonator and antenna
 Summary | Full Text:PDF

MIMO Radar Waveforms Using Orthogonal Complementary Codes with Doppler-Offset
Takaaki KISHIGAMI Hidekuni YOMO Naoya YOSOKU Akihiko MATSUOKA Junji SATO 
Publication Date: 2018/06/01
Vol. E101-B  No. 6 ; pp. 1503-1512
Type of Manuscript:  PAPER
Category: Sensing
radarMIMO waveformsmillimeter-wavecomplementary codesorthogonal codedirection of arrival
 Summary | Full Text:PDF

Multi-Dimensional Radio Channel Measurement, Analysis and Modeling for High Frequency Bands
Minseok KIM Jun-ichi TAKADA Kentaro SAITO 
Publication Date: 2018/02/01
Vol. E101-B  No. 2 ; pp. 293-308
Type of Manuscript:  INVITED PAPER (Special Section on Recent Progress in Antennas and Propagation in Conjunction with Main Topics of ISAP2016)
radio channelpropagationchannel sounderchannel modelhigh frequencymillimeter-waveMIMO
 Summary | Full Text:PDF

An Efficient Handover Measurement Technique for Millimeter-Wave Cellular Communications
Jasper Meynard P. ARANA Rothna PEC Yong Soo CHO 
Publication Date: 2018/02/01
Vol. E101-B  No. 2 ; pp. 592-602
Type of Manuscript:  PAPER
Category: Terrestrial Wireless Communication/Broadcasting Technologies
millimeter-wavecellular communicationbeam synchronization signalinterbeam handoverintercell handover
 Summary | Full Text:PDF

A CMOS Broadband Transceiver with On-Chip Antenna Array and Built-In Pulse-Delay Calibration for Millimeter-Wave Imaging Applications
Publication Date: 2017/12/01
Vol. E100-C  No. 12 ; pp. 1078-1086
Type of Manuscript:  PAPER
Category: Microwaves, Millimeter-Waves
transceiverbroadbandCMOSmillimeter-waveintegrated circuitpulse generatorantennaactive imaging
 Summary | Full Text:PDF

Evolution of Millimeter-Wave Multi-Antenna Systems in the IoT Era
Publication Date: 2017/10/01
Vol. E100-C  No. 10 ; pp. 809-817
Type of Manuscript:  INVITED PAPER (Special Section on Microwave and Millimeter-Wave Technology)
IoTmillimeter-wave5Gradarphased arrayMIMO
 Summary | Full Text:PDF

Recent Technologies in Japan on Array Antennas for Wireless Systems
Publication Date: 2017/09/01
Vol. E100-B  No. 9 ; pp. 1644-1652
Type of Manuscript:  INVITED SURVEY PAPER
Category: Antennas and Propagation
array antennamultiple antennacomputational electromagneticsmillimeter-waveantenna measurementsignal processing
 Summary | Full Text:PDF

Self-Organized Beam Scheduling as an Enabler for Coexistence in 5G Unlicensed Bands
Maziar NEKOVEE Yinan QI Yue WANG 
Publication Date: 2017/08/01
Vol. E100-B  No. 8 ; pp. 1181-1189
Type of Manuscript:  INVITED PAPER (Special Section on Radio Access Technologies for 5G Mobile Communications System)
Category: Wireless Communication Technologies
millimeter-wave5Glicensed and unlicensed bandscoexistencespectrum sharing
 Summary | Full Text:PDF

Analysis of Effective Material Properties of Metal Dummy Fills in a CMOS Chip
Takuichi HIRANO Ning LI Kenichi OKADA 
Publication Date: 2017/05/01
Vol. E100-B  No. 5 ; pp. 793-798
Type of Manuscript:  PAPER
Category: Antennas and Propagation
dummy metal fillsCMOSeffective material propertypermittivitypermeabilitymillimeter-wave
 Summary | Full Text:PDF

An Iteration Based Beamforming Method for Planar Phased Array in Millimeter-Wave Communication
Junlin TANG Guangrong YUE Lei CHEN Shaoqian LI 
Publication Date: 2017/04/01
Vol. E100-C  No. 4 ; pp. 399-406
Type of Manuscript:  PAPER
Category: Electromagnetic Theory
millimeter-wavebeamformingiterationphased array
 Summary | Full Text:PDF

A Spectrum-Based Saliency Detection Algorithm for Millimeter-Wave InSAR Imaging with Sparse Sensing
Yilong ZHANG Yuehua LI Safieddin SAFAVI-NAEINI 
Publication Date: 2017/02/01
Vol. E100-D  No. 2 ; pp. 388-391
Type of Manuscript:  LETTER
Category: Image Recognition, Computer Vision
 Summary | Full Text:PDF

A Low Power Buffer-Feedback Oscillator with Current Reused Structure
Chang-Wan KIM Dat NGUYEN Jong-Phil HONG 
Publication:   IEICE TRANSACTIONS on Electronics
Publication Date: 2016/12/01
Vol. E99-C  No. 12 ; pp. 1335-1338
Type of Manuscript:  BRIEF PAPER
Category: Electronic Circuits
millimeter-wavelow powerbuffer-feedbackoscillator
 Summary | Full Text:PDF

A Compact Millimeter-Wave Dual-Band Bandpass Filter Using Substrate-Integrated Waveguide (SIW) Dual-Mode Cavities
Kaida DONG Jingyan MO Yuhong HE Zhewang MA Xuexia YANG 
Publication:   IEICE TRANSACTIONS on Electronics
Publication Date: 2016/07/01
Vol. E99-C  No. 7 ; pp. 761-765
Type of Manuscript:  Special Section PAPER (Special Section on Recent Advances in Simulation Techniques and Their Applications for Electronics)
millimeter-wavesubstrate-integrated waveguide (SIW)bandpass filterdual-modedual-band
 Summary | Full Text:PDF

RCS Measurements for Vehicles and Pedestrian at 26 and 79GHz
Publication:   IEICE TRANSACTIONS on Fundamentals of Electronics, Communications and Computer Sciences
Publication Date: 2016/01/01
Vol. E99-A  No. 1 ; pp. 204-206
Type of Manuscript:  Special Section LETTER (Special Section on Wideband Systems)
automotive radarmillimeter-waveradar cross section
 Summary | Full Text:PDF

Beyond 110 GHz InP-HEMT Based Mixer Module Using Flip-Chip Assembly for Precise Spectrum Analysis
Shoichi SHIBA Masaru SATO Hiroshi MATSUMURA Yoichi KAWANO Tsuyoshi TAKAHASHI Toshihide SUZUKI Yasuhiro NAKASHA Taisuke IWAI Naoki HARA 
Publication:   IEICE TRANSACTIONS on Electronics
Publication Date: 2015/12/01
Vol. E98-C  No. 12 ; pp. 1112-1119
Type of Manuscript:  Special Section PAPER (Special Section on Terahertz Waves Coming to the Real World)
millimeter-waveInP HEMTsfundamental mixerflip chipwaveguide modulespectrum analysis
 Summary | Full Text:PDF

Low Complexity Millimeter-Wave LOS-MIMO Systems with Uniform Circular Arrays for Small Cells Wireless Backhaul
Publication:   IEICE TRANSACTIONS on Communications
Publication Date: 2015/11/01
Vol. E98-B  No. 11 ; pp. 2348-2358
Type of Manuscript:  PAPER
Category: Wireless Communication Technologies
channel capacityBERLOS-MIMOmillimeter-waveprecodingspatial interleaver5Gsmall cellswireless backhauluniform circular arrays (UCAs)
 Summary | Full Text:PDF

LTE/WiGig RAN-Level Interworking Architecture for 5G Millimeter-Wave Heterogeneous Networks
Hailan PENG Toshiaki YAMAMOTO Yasuhiro SUEGARA 
Publication:   IEICE TRANSACTIONS on Communications
Publication Date: 2015/10/01
Vol. E98-B  No. 10 ; pp. 1957-1968
Type of Manuscript:  Special Section PAPER (Special Section on 5G Radio Access Networks―Part II: Multi-RAT Heterogeneous Networks and Smart Radio Technologies)
5Gmillimeter-waveLTE60GHzWiGigextended user/control planeC/U-plane splittingbeamforming
 Summary | Full Text:PDF

A Novel Beam Search Method in Millimeter-Wave Access Networks for 5G Mobile Communications
Shunsuke FUJIO Chimato KOIKE Dai KIMURA 
Publication:   IEICE TRANSACTIONS on Communications
Publication Date: 2015/08/01
Vol. E98-B  No. 8 ; pp. 1456-1464
Type of Manuscript:  Special Section PAPER (Special Section on 5G Radio Access Networks―Part I: Radio Access Technologies and System Design)
5Gmillimeter-wavebeamformingbeam search
 Summary | Full Text:PDF

Channel Models and Beamforming at Millimeter-Wave Frequency Bands
Katsuyuki HANEDA 
Publication:   IEICE TRANSACTIONS on Communications
Publication Date: 2015/05/01
Vol. E98-B  No. 5 ; pp. 755-772
Type of Manuscript:  INVITED PAPER (Special Section on Recent Progress in Radio Propagation)
millimeter-wavechannel modelradio wave propagationbeamformingantennasfifth-generation5G
 Summary | Full Text:PDF

Millimeter-Wave Evolution for 5G Cellular Networks
Kei SAKAGUCHI Gia Khanh TRAN Hidekazu SHIMODAIRA Shinobu NANBA Toshiaki SAKURAI Koji TAKINAMI Isabelle SIAUD Emilio Calvanese STRINATI Antonio CAPONE Ingolf KARLS Reza AREFI Thomas HAUSTEIN 
Publication:   IEICE TRANSACTIONS on Communications
Publication Date: 2015/03/01
Vol. E98-B  No. 3 ; pp. 388-402
Type of Manuscript:  Special Section PAPER (Special Section on Position Papers Exploring Innovative Intelligence and Technologies in Communications)
millimeter-wave5G cellular networksmall cellC-RANsystem rate gain
 Summary | Full Text:PDF

Characterization of Crossing Transmission Line Using Two-Port Measurements for Millimeter-Wave CMOS Circuit Design
Korkut Kaan TOKGOZ Kimsrun LIM Seitarou KAWAI Nurul FAJRI Kenichi OKADA Akira MATSUZAWA 
Publication:   IEICE TRANSACTIONS on Electronics
Publication Date: 2015/01/01
Vol. E98-C  No. 1 ; pp. 35-44
Type of Manuscript:  PAPER
Category: Microwaves, Millimeter-Waves
crossing transmission linede-embeddingcharacterizationmillimeter-wavereduced port
 Summary | Full Text:PDF

A Simple Through-Hole Based Transformer between Microstrip Line and Post-Wall Waveguide for Millimeter-Wave Applications
Publication:   IEICE TRANSACTIONS on Electronics
Publication Date: 2014/10/01
Vol. E97-C  No. 10 ; pp. 941-947
Type of Manuscript:  Special Section PAPER (Special Section on Recent Progress in Microwave and Millimeter-wave Technologies)
post-wall waveguidetransformerliquid crystal polymermillimeter-wave
 Summary | Full Text:PDF

120-GHz-Band Amplifier Module with Hermetic Sealing Structure for 10-Gbit/s Wireless System
Publication:   IEICE TRANSACTIONS on Electronics
Publication Date: 2014/06/01
Vol. E97-C  No. 6 ; pp. 583-591
Type of Manuscript:  PAPER
Category: Electronic Components
millimeter-wavewaveguideconnection techniquewireless communication
 Summary | Full Text:PDF

Millimeter-Wave Propagation Characteristics and Localized Rain Effects in a Small-Scale University Campus Network in Tokyo
Publication:   IEICE TRANSACTIONS on Communications
Publication Date: 2014/05/01
Vol. E97-B  No. 5 ; pp. 1012-1021
Type of Manuscript:  PAPER
Category: Antennas and Propagation
millimeter-waverain attenuationlocalized rainspatial variability of rainfalldiversity
 Summary | Full Text:PDF

Performance Evaluation of Short-Range MIMO Using a Method for Controlling Phase Difference between Each Propagation Channel
Kazumitsu SAKAMOTO Ken HIRAGA Tomohiro SEKI Tadao NAKAGAWA Kazuhiro UEHARA 
Publication:   IEICE TRANSACTIONS on Communications
Publication Date: 2013/10/01
Vol. E96-B  No. 10 ; pp. 2513-2520
Type of Manuscript:  Special Section PAPER (Special Section on Recent Progress in Antennas and Propagation in Conjunction with Main Topics of ISAP2012)
Category: Adaptive Array Antennas/MIMO
short-range MIMOcontrolling phase differencepower ratiosub-array antennamillimeter-wavesimple decoding method
 Summary | Full Text:PDF

Advanced Millimeter-Wave Radar System to Detect Pedestrians and Vehicles by Using Coded Pulse Compression and Adaptive Array
Takaaki KISHIGAMI Tadashi MORITA Hirohito MUKAI Maiko OTANI Yoichi NAKAGAWA 
Publication:   IEICE TRANSACTIONS on Communications
Publication Date: 2013/09/01
Vol. E96-B  No. 9 ; pp. 2313-2322
Type of Manuscript:  PAPER
Category: Sensing
radarmillimeter-wavepulse compressiondirection of arrivalDOAintelligent transport systemITS
 Summary | Full Text:PDF

60 GHz Millimeter-Wave CMOS Integrated On-Chip Open Loop Resonator Bandpass Filters on Patterned Ground Shields
Ramesh K. POKHAREL Xin LIU Dayang A.A. MAT Ruibing DONG Haruichi KANAYA Keiji YOSHIDA 
Publication:   IEICE TRANSACTIONS on Electronics
Publication Date: 2013/02/01
Vol. E96-C  No. 2 ; pp. 270-276
Type of Manuscript:  PAPER
Category: Microwaves, Millimeter-Waves
millimeter-waveon-chip band pass filterpattern ground shieldsfolded structuresystem on chip
 Summary | Full Text:PDF

Electro-Optic Modulators Using Double Antenna-Coupled Electrodes for Radio-over-Fiber Systems
Naohiro KOHMU Hiroshi MURATA Yasuyuki OKAMURA 
Publication:   IEICE TRANSACTIONS on Electronics
Publication Date: 2013/02/01
Vol. E96-C  No. 2 ; pp. 204-211
Type of Manuscript:  Special Section PAPER (Special Section on Recent Progress in Microwave and Millimeter-Wave Photonics Technology)
electro-optic modulatorpatch antennaresonant electrodemillimeter-waveradio-over-fiber
 Summary | Full Text:PDF

A 60 GHz CMOS Transceiver IC for a Short-Range Wireless System with Amplitude/Phase Imbalance Cancellation Technique
Publication:   IEICE TRANSACTIONS on Electronics
Publication Date: 2012/10/01
Vol. E95-C  No. 10 ; pp. 1598-1609
Type of Manuscript:  Special Section PAPER (Special Section on Recent Progress in Microwave and Millimeter-Wave Technologies)
CMOSmillimeter-wavedirect conversionamplitude/phase imbalancephase locked loop (PLL)injection locked frequency dividercalibrationpush-push voltage controlled oscillator60 GHz
 Summary | Full Text:PDF

60-GHz Band Copper Ball Vertical Interconnection for MMW 3-D System-in-Package Front-End Modules
Publication:   IEICE TRANSACTIONS on Electronics
Publication Date: 2012/07/01
Vol. E95-C  No. 7 ; pp. 1276-1284
Type of Manuscript:  PAPER
Category: Microwaves, Millimeter-Waves
millimeter-wave60-GHz bandsystem-in-packagevertical interconnectioncopper ballsWPAN
 Summary | Full Text:PDF

A 60 GHz-Band 3-Dimensional System-in-Package Transmitter Module with Integrated Antenna
Publication:   IEICE TRANSACTIONS on Electronics
Publication Date: 2012/07/01
Vol. E95-C  No. 7 ; pp. 1141-1146
Type of Manuscript:  INVITED PAPER (Special Section on Recent Trends of Microwave Systems and Their Fundamental Technologies)
moduleRFICMMICantenna integrationmillimeter-waveSiPstud bump
 Summary | Full Text:PDF

A 28-GHz, -187.4-dBc/Hz-FOMT Low-Phase-Noise CMOS VCO Using an Amplitude-Redistribution Technique
Yusuke WACHI Toshiyuki NAGASAKU Hiroshi KONDOH 
Publication:   IEICE TRANSACTIONS on Electronics
Publication Date: 2012/06/01
Vol. E95-C  No. 6 ; pp. 1042-1049
Type of Manuscript:  Special Section PAPER (Special Section on Analog Circuits and Related SoC Integration Technologies)
 Summary | Full Text:PDF

Broadband Millimeter-Wave Microstrip Comb-Line Antenna Using Corporate Feeding System with Center-Connecting
Atsushi KUNITA Kunio SAKAKIBARA Kazuyuki SEO Nobuyoshi KIKUMA Hiroshi HIRAYAMA 
Publication:   IEICE TRANSACTIONS on Communications
Publication Date: 2012/01/01
Vol. E95-B  No. 1 ; pp. 41-50
Type of Manuscript:  Special Section PAPER (Special Section on Recent Progress in Antennas and Propagation in Conjunction with Main Topics of ISAP2010)
Category: Antennas
millimeter-wavemicrostrip antennaarray antenna
 Summary | Full Text:PDF

A 65-nm CMOS Fully Integrated Shock-Wave Antenna Array with On-Chip Jitter and Pulse-Delay Adjustment for Millimeter-Wave Active Imaging Application
Nguyen Ngoc MAI KHANH Masahiro SASAKI Kunihiro ASADA 
Publication:   IEICE TRANSACTIONS on Fundamentals of Electronics, Communications and Computer Sciences
Publication Date: 2011/12/01
Vol. E94-A  No. 12 ; pp. 2554-2562
Type of Manuscript:  Special Section PAPER (Special Section on VLSI Design and CAD Algorithms)
Category: Device and Circuit Modeling and Analysis
beam-formingon-chip antenna arrayintegrated circuitCMOSjitter measurementwide-bandmillimeter-waveactive imaging
 Summary | Full Text:PDF

A 0.25-µm Si-Ge Fully Integrated Pulse Transmitter with On-Chip Loop Antenna Array towards Beam-Formability for Millimeter-Wave Active Imaging
Nguyen Ngoc MAI KHANH Masahiro SASAKI Kunihiro ASADA 
Publication:   IEICE TRANSACTIONS on Electronics
Publication Date: 2011/10/01
Vol. E94-C  No. 10 ; pp. 1626-1633
Type of Manuscript:  Special Section PAPER (Special Section on Microwave and Millimeter-Wave Technology)
Category: Microwave and Millimeter-Wave Antennas
pulse transmitterloop antennamillimeter-waveintegrated circuitarray antenna
 Summary | Full Text:PDF

Analyses of Antenna Displacement in Short-Range MIMO Transmission over Millimeter-Wave
Ken HIRAGA Tomohiro SEKI Kentaro NISHIMORI Kenjiro NISHIKAWA Ichihiko TOYODA Kazuhiro UEHARA 
Publication:   IEICE TRANSACTIONS on Communications
Publication Date: 2011/10/01
Vol. E94-B  No. 10 ; pp. 2891-2895
Type of Manuscript:  LETTER
Category: Antennas and Propagation
short-rangeMIMOmillimeter-waveantennasparallel transmission
 Summary | Full Text:PDF

Performance Analysis of a 10-Gb/s Millimeter-Wave Impulse Radio Transmitter
Yasuhiro NAKASHA Naoki HARA Kiyomichi ARAKI 
Publication:   IEICE TRANSACTIONS on Electronics
Publication Date: 2011/10/01
Vol. E94-C  No. 10 ; pp. 1557-1564
Type of Manuscript:  Special Section PAPER (Special Section on Microwave and Millimeter-Wave Technology)
Category: Active Devices and Circuits
impulse radiomillimeter-wavepulse generatorband-pass filterjitterintersymbol interference
 Summary | Full Text:PDF

A 60 GHz High Gain Transformer-Coupled Differential Cascode Power Amplifier in 65 nm CMOS
Jenny Yi-Chun LIU Mau-Chung Frank CHANG 
Publication:   IEICE TRANSACTIONS on Electronics
Publication Date: 2011/10/01
Vol. E94-C  No. 10 ; pp. 1508-1514
Type of Manuscript:  Special Section PAPER (Special Section on Microwave and Millimeter-Wave Technology)
Category: Active Devices and Circuits
CMOSmillimeter-waveintegrated circuitspower amplifierV-band
 Summary | Full Text:PDF

Phase Control and Calibration Characteristics of Optically Controlled Phased Array Antenna Feed Using Multiple SMFs
Publication:   IEICE TRANSACTIONS on Electronics
Publication Date: 2011/10/01
Vol. E94-C  No. 10 ; pp. 1634-1640
Type of Manuscript:  Special Section PAPER (Special Section on Microwave and Millimeter-Wave Technology)
Category: Microwave and Millimeter-Wave Antennas
optically controlled phased array antennaSMFLDmicrowavemillimeter-wavecalibration
 Summary | Full Text:PDF

On Communication and Interference Range of Multi-Gbps Millimeter-Wave WPAN System
Chin-Sean SUM Zhou LAN Junyi WANG Hiroshi HARADA Shuzo KATO 
Publication:   IEICE TRANSACTIONS on Fundamentals of Electronics, Communications and Computer Sciences
Publication Date: 2010/12/01
Vol. E93-A  No. 12 ; pp. 2700-2703
Type of Manuscript:  Special Section LETTER (Special Section on Wideband Systems)
interference rangecommunication rangemillimeter-wavemulti-gigabitWPAN
 Summary | Full Text:PDF

Development of Millimeter-Wave Mobile Camera and Performance Improvement in Outdoor LOS Environment
Shinichi SUZUKI Takayuki NAKAGAWA Tetsuomi IKEDA 
Publication:   IEICE TRANSACTIONS on Fundamentals of Electronics, Communications and Computer Sciences
Publication Date: 2010/11/01
Vol. E93-A  No. 11 ; pp. 2099-2107
Type of Manuscript:  Special Section PAPER (Special Section on Smart Multimedia & Communication Systems)
millimeter-waveMIMO-OFDMHi-Vision TVlow-latencyoutdoor transmissionorthogonally polarized waves
 Summary | Full Text:PDF

Control of Power Dividing Ratio in Four-Way Power Divider for Feeding Microstrip Comb-Line Antenna
Morihiko NANJO Kunio SAKAKIBARA Nobuyoshi KIKUMA Hiroshi HIRAYAMA 
Publication:   IEICE TRANSACTIONS on Communications
Publication Date: 2010/10/01
Vol. E93-B  No. 10 ; pp. 2651-2654
Type of Manuscript:  Special Section LETTER (Special Section on Advanced Technologies in Antennas and Propagation in Conjunction with Main Topics of ISAP2009)
Category: Antennas
millimeter-wavearray antennamicrostrip antennacomb-line antenna
 Summary | Full Text:PDF

A Low Power V-Band Injection-Locked Frequency Divider in 0.13-µm Si RFCMOS Technology
Seungwoo SEO Jae-Sung RIEH 
Publication:   IEICE TRANSACTIONS on Electronics
Publication Date: 2010/05/01
Vol. E93-C  No. 5 ; pp. 614-618
Type of Manuscript:  Special Section PAPER (Special Section on Fundamentals and Applications of Advanced Semiconductor Devices)
Category: Analog/RF Devices
millimeter-waveRFCMOSinjection locked frequency divider
 Summary | Full Text:PDF

60-GHz Self-Heterodyne Through-Repeater Systems with Suppressed Third-Order Intermodulation Distortions
Chang-Soon CHOI Yozo SHOJI Hiroki OHTA 
Publication:   IEICE TRANSACTIONS on Electronics
Publication Date: 2010/01/01
Vol. E93-C  No. 1 ; pp. 94-100
Type of Manuscript:  PAPER
Category: Microwaves, Millimeter-Waves
millimeter-wavewireless repeaterdigital broadcastingself-heterodyneintermodulation distortion
 Summary | Full Text:PDF

A Novel Composite Right/Left-Handed Rectangular Waveguide with Tilted Corrugations and Its Application to Millimeter-Wave Frequency-Scanning Antenna
Toru IWASAKI Hirokazu KAMODA Takao KUKI 
Publication:   IEICE TRANSACTIONS on Communications
Publication Date: 2009/12/01
Vol. E92-B  No. 12 ; pp. 3843-3849
Type of Manuscript:  PAPER
Category: Antennas and Propagation
metamaterialscomposite right/left-handed transmission linescorrugated waveguidefrequency-scanning antennamillimeter-wave
 Summary | Full Text:PDF

An Improved Nonlinear Circuit Model for GaAs Gunn Diode in W-Band Oscillator
Bo ZHANG Yong FAN Yonghong ZHANG 
Publication:   IEICE TRANSACTIONS on Electronics
Publication Date: 2009/12/01
Vol. E92-C  No. 12 ; pp. 1490-1495
Type of Manuscript:  PAPER
Category: Microwaves, Millimeter-Waves
millimeter-waveGaAs Gunn diodenonlinear circuit modelphysical mechanismoscillator
 Summary | Full Text:PDF

Throughput and Error Analysis of a Space-Time Resource Management Scheme for Multi-Gbps Millimeter-Wave WPAN System
Chin-Sean SUM Mohammad Azizur RAHMAN Zhou LAN Ryuhei FUNADA Junyi WANG Tuncer BAYKAS Hiroshi HARADA Shuzo KATO 
Publication:   IEICE TRANSACTIONS on Fundamentals of Electronics, Communications and Computer Sciences
Publication Date: 2009/11/01
Vol. E92-A  No. 11 ; pp. 2659-2668
Type of Manuscript:  Special Section PAPER (Special Section on Wideband Systems)
space-timeresource managementmillimeter-wavemulti-GbpsWPANcross layer
 Summary | Full Text:PDF

High-Attenuation Power Line for Wideband Decoupling
Publication:   IEICE TRANSACTIONS on Electronics
Publication Date: 2009/06/01
Vol. E92-C  No. 6 ; pp. 792-797
Type of Manuscript:  Special Section PAPER (Special Section on Analog Circuits and Related SoC Integration Technologies)
CMOSdecouplingmillimeter-wavepower line
 Summary | Full Text:PDF

Development of High-Frequency GaN HFETs for Millimeter-Wave Applications
Masataka HIGASHIWAKI Takashi MIMURA Toshiaki MATSUI 
Publication:   IEICE TRANSACTIONS on Electronics
Publication Date: 2008/07/01
Vol. E91-C  No. 7 ; pp. 984-988
Type of Manuscript:  INVITED PAPER (Special Section on Heterostructure Microelectronics with TWHM 2007)
GaNheterostructure field-effect transistors (HFETs)millimeter-wave
 Summary | Full Text:PDF

High-Performance 76-GHz Planar Gunn VCO
Publication:   IEICE TRANSACTIONS on Electronics
Publication Date: 2008/07/01
Vol. E91-C  No. 7 ; pp. 1098-1103
Type of Manuscript:  Special Section PAPER (Special Section on Heterostructure Microelectronics with TWHM 2007)
Category: GaAs- and InP-Based Devices
Gunn VCOflip-chipmillimeter-wavetuning-frequency rangelaser micromachining
 Summary | Full Text:PDF

Bidirectional Gigabit Millimeter-Wave Wavelength Division Multiplexed-Radio over Fiber Link Using a Reflective Semiconductor Optical Amplifier
Dae-Won LEE Yong-Yuk WON Sang-Kook HAN 
Publication:   IEICE TRANSACTIONS on Communications
Publication Date: 2008/07/01
Vol. E91-B  No. 7 ; pp. 2418-2421
Type of Manuscript:  LETTER
Category: Wireless Communication Technologies
reflective semiconductor optical amplifiermillimeter-wavewavelength division multiplexingradio over fiber
 Summary | Full Text:PDF

High Moisture Resistant and Reliable Gate Structure Design in High Power pHEMTs for Millimeter-Wave Applications
Hirotaka AMASUGA Toshihiko SHIGA Masahiro TOTSUKA Seiki GOTO Akira INOUE 
Publication:   IEICE TRANSACTIONS on Electronics
Publication Date: 2008/05/01
Vol. E91-C  No. 5 ; pp. 676-682
Type of Manuscript:  Special Section PAPER (Special Section on Fundamentals and Applications of Advanced Semiconductor Devices)
millimeter-waveGaAspHEMThumiditypower densitybreakdown voltage
 Summary | Full Text:PDF

Wideband 3/4 Elliptical Ring Patch for Millimeter-Wave Communication
Wei HE Ronghong JIN Junping GENG Guomin YANG 
Publication:   IEICE TRANSACTIONS on Communications
Publication Date: 2007/12/01
Vol. E90-B  No. 12 ; pp. 3742-3744
Type of Manuscript:  LETTER
Category: Antennas and Propagation
elliptical ring patchwidebandcircular polarizationmillimeter-wave

This letter was withdrawn by the authors. The withdrawal procedure has been completed on October 24, 2008.

 Summary | Full Text:PDF

Millimeter-Wave High-Power MMIC Switch with Multiple FET Resonators
Masatake HANGAI Tamotsu NISHINO Morishige HIEDA Kunihiro ENDO Moriyasu MIYAZAKI 
Publication:   IEICE TRANSACTIONS on Electronics
Publication Date: 2007/09/01
Vol. E90-C  No. 9 ; pp. 1695-1701
Type of Manuscript:  Special Section PAPER (Special Section on Microwave and Millimeter-Wave Technology)
Category: Active Devices/Circuits
switchFETFET resonatormillimeter-wavehigh-powerlow-lossMMICs
 Summary | Full Text:PDF

Application of Microwave and Millimeter-Wave Circuit Technologies to InGaP-HBT ICs for 40-Gbps Optical Transmission Systems
Ken'ichi HOSOYA Yasuyuki SUZUKI Yasushi AMAMIYA Zin YAMAZAKI Masayuki MAMADA Akira FUJIHARA Masafumi KAWANAKA Shin'ichi TANAKA Shigeki WADA Hikaru HIDA 
Publication:   IEICE TRANSACTIONS on Electronics
Publication Date: 2007/09/01
Vol. E90-C  No. 9 ; pp. 1685-1694
Type of Manuscript:  Special Section PAPER (Special Section on Microwave and Millimeter-Wave Technology)
Category: Active Devices/Circuits
microwavemillimeter-waveMMICGaAs HBToptical transmission systemdistributed amplifierfrequency doublerphase shifterflip flopjitterimpedance matching
 Summary | Full Text:PDF

UTC-PD-Based Optoelectronic Components for High-Frequency and High-Speed Applications
Satoshi KODAMA Hiroshi ITO 
Publication:   IEICE TRANSACTIONS on Electronics
Publication Date: 2007/02/01
Vol. E90-C  No. 2 ; pp. 429-435
Type of Manuscript:  INVITED PAPER (Special Section on Evolution of Microwave and Millimeter-Wave Photonics Technology)
uni-traveling-carrier photodiode (UTC-PD)optoelectronic devicehigh speedhigh frequencymillimeter-wavemonolithic integrationoptical gatesignal processing
 Summary | Full Text:PDF

Moment Method Analysis of a Plane Wave Generator in an Oversized Rectangular Waveguide
Takafumi KAI Jiro HIROKAWA Makoto ANDO 
Publication:   IEICE TRANSACTIONS on Communications
Publication Date: 2007/01/01
Vol. E90-B  No. 1 ; pp. 105-113
Type of Manuscript:  PAPER
Category: Antennas and Propagation
millimeter-waveplane wave generatoroversized rectangular waveguidemoment methodeigenmode
 Summary | Full Text:PDF

RF MEMS--Enabling Technology for Millimeter-Waves
Youngwoo KWON Sanghyo LEE 
Publication:   IEICE TRANSACTIONS on Electronics
Publication Date: 2006/07/01
Vol. E89-C  No. 7 ; pp. 898-905
Type of Manuscript:  INVITED PAPER (Special Section on Heterostructure Microelectronics with TWHM2005)
MEMSmillimeter-wavemicromachiningpassive device
 Summary | Full Text:PDF

Millimeter-Wave Broadband Mixers in New Testing and Measurement Instruments for High Data Rate Signal Analyses
Publication:   IEICE TRANSACTIONS on Electronics
Publication Date: 2005/10/01
Vol. E88-C  No. 10 ; pp. 1973-1980
Type of Manuscript:  Special Section PAPER (Special Section on Recent Technologies on Devices, Circuits, and Systems for Millimeter-wave ITS Applications)
millimeter-wavespectrum analyzermixerresistive mixerbalun
 Summary | Full Text:PDF

77-GHz MMIC Module Design Techniques for Automotive Radar Applications
Yasushi ITOH Kazuhiko HONJO 
Publication:   IEICE TRANSACTIONS on Electronics
Publication Date: 2005/10/01
Vol. E88-C  No. 10 ; pp. 1939-1946
Type of Manuscript:  REVIEW PAPER
millimeter-waveMMICmoduleautomotive radar sensorMCMSiPSoCflip-chip
 Summary | Full Text:PDF

A Millimeter-Wave Pulse Transmitter with a Harmonic Mixer
Publication:   IEICE TRANSACTIONS on Electronics
Publication Date: 2005/10/01
Vol. E88-C  No. 10 ; pp. 1947-1951
Type of Manuscript:  Special Section PAPER (Special Section on Recent Technologies on Devices, Circuits, and Systems for Millimeter-wave ITS Applications)
millimeter-wavepulse transmitterharmonic mixer
 Summary | Full Text:PDF

Fiber-Optic Broadband Signal Distribution Link Based on a Millimeter-Wave Self-Heterodyne Transmission/Optical Remote Heterodyne Detection Technique
Yozo SHOJI Yoshihiro HASHIMOTO Hiroyo OGAWA 
Publication:   IEICE TRANSACTIONS on Electronics
Publication Date: 2005/07/01
Vol. E88-C  No. 7 ; pp. 1465-1474
Type of Manuscript:  Special Section PAPER (Special Section on Recent Technologies of Microwave and Millimeter-Wave Devices Focusing on Miniaturization and Advancement in Performance with Their Applications)
Category: Communication Systems
millimeter-waveoptical remote heterodyneself-heterodyneoptical SSB modulator
 Summary | Full Text:PDF

Low Phase Noise, InGaP/GaAs HBT VCO MMIC for Millimeter-Wave Applications
Satoshi KURACHI Toshihiko YOSHIMASU 
Publication:   IEICE TRANSACTIONS on Electronics
Publication Date: 2005/04/01
Vol. E88-C  No. 4 ; pp. 678-682
Type of Manuscript:  Special Section PAPER (Special Section on Fundamental and Application of Advanced Semiconductor Devices)
Category: Compound Semiconductor Devices
InGaP/GaAs HBTVCOmillimeter-wavelow phase noise
 Summary | Full Text:PDF

Guided-Wave Electro-Optic Modulators Using Novel Electrode Structure of Coupled Microstrip Line Resonator
Akira ENOKIHARA Hiroyoshi YAJIMA Hiroshi MURATA Yasuyuki OKAMURA 
Publication:   IEICE TRANSACTIONS on Electronics
Publication Date: 2005/03/01
Vol. E88-C  No. 3 ; pp. 372-378
Type of Manuscript:  Special Section PAPER (Special Section on Optical Signal-Processing Devices for Photonic Networks)
modulatoroptical waveguideresonator electrodemillimeter-waveradio-on-fiber
 Summary | Full Text:PDF

Complex Refractive Index of Soda-Lime Glass: Measurement at 30-GHz and Empirical Formula in Microwave and Millimeter-Wave Regions
Toshio IHARA Tomohiro OGUCHI Tamio TAZAKI 
Publication:   IEICE TRANSACTIONS on Communications
Publication Date: 2004/10/01
Vol. E87-B  No. 10 ; pp. 3155-3157
Type of Manuscript:  LETTER
Category: Antennas and Propagation
refractive indexglassempirical formulamicrowavemillimeter-wave
 Summary | Full Text:PDF

Modeling the Point-to-Point Wireless Communication Channel under the Adverse Weather Conditions
Publication:   IEICE TRANSACTIONS on Electronics
Publication Date: 2004/09/01
Vol. E87-C  No. 9 ; pp. 1455-1462
Type of Manuscript:  Special Section PAPER (Special Section on Wave Technologies for Wireless and Optical Communications)
Category: Antennas and Propagation for Wireless Communications
multiple scatteringradiative transfer theoryrandom mediaoptical wave propagationfree space opticsmillimeter-wave
 Summary | Full Text:PDF

Image NRD Guide-Fed Dielectric Rod Antenna for Millimeter-Wave Applications
Ally Yahaya SIMBA Manabu YAMAMOTO Toshio NOJIMA Kiyohiko ITOH 
Publication:   IEICE TRANSACTIONS on Electronics
Publication Date: 2004/09/01
Vol. E87-C  No. 9 ; pp. 1405-1411
Type of Manuscript:  Special Section PAPER (Special Section on Wave Technologies for Wireless and Optical Communications)
Category: Antennas, Circuits and Receivers
dielectric rod antennaimage NRD guidemillimeter-wavetransitionFDTD
 Summary | Full Text:PDF

Simple Millimeter-Wave Quasi-Maximal-Ratio-Combining Antenna Diversity System Based on Millimeter-Wave Self-heterodyne Transmission Technique
Yozo SHOJI Hiroyo OGAWA 
Publication:   IEICE TRANSACTIONS on Communications
Publication Date: 2004/08/01
Vol. E87-B  No. 8 ; pp. 2203-2211
Type of Manuscript:  PAPER
Category: Wireless Communication Technology
 Summary | Full Text:PDF

100-GHz Ultra-Broadband Distributed Amplifier in Chip-Size Package
Satoshi MASUDA Kazuhiko KOBAYASHI Hidehiko KIRA Masayuki KITAJIMA Kazukiyo JOSHIN 
Publication:   IEICE TRANSACTIONS on Electronics
Publication Date: 2004/07/01
Vol. E87-C  No. 7 ; pp. 1197-1203
Type of Manuscript:  PAPER
Category: Microwaves, Millimeter-Waves
chip-size package (CSP)distributed amplifierinverted microstrip linegrounded coplanar waveguideflip-chipInP HEMTmillimeter-wavelead-free solder
 Summary | Full Text:PDF

Effects of Various Rare Earth Sesquioxide Additives on Grain Growth in Millimeter-Wave Sintered Silicon Nitride Ceramics
Masayuki HIROTA Maria-Cecilia VALECILLOS Manuel E. BRITO Kiyoshi HIRAO Motohiro TORIYAMA 
Publication:   IEICE TRANSACTIONS on Electronics
Publication Date: 2003/12/01
Vol. E86-C  No. 12 ; pp. 2462-2468
Type of Manuscript:  Special Section PAPER (Special Issue on Recent Trends on Microwave and Millimeter Wave Application Technology)
Category: Millimeter-Wave Heating
silicon nitridemillimeter-wavemicrostructuresinteringgrain growth
 Summary | Full Text:PDF

26 GHz Bandpass Filter and Duplexer Using TM11δ Mode Dielectric Resonators with High-Q Performance and Compact Configuration
Publication:   IEICE TRANSACTIONS on Electronics
Publication Date: 2003/11/01
Vol. E86-C  No. 11 ; pp. 2283-2291
Type of Manuscript:  PAPER
Category: Microwaves, Millimeter-Waves
filterduplexermillimeter-waveTM11δ rectan-gular-modedielectric resonatorsurface mount
 Summary | Full Text:PDF

Millimeter-Wave Microstrip Array Antenna for Automotive Radars
Hideo IIZUKA Toshiaki WATANABE Kazuo SATO Kunitoshi NISHIKAWA 
Publication:   IEICE TRANSACTIONS on Communications
Publication Date: 2003/09/01
Vol. E86-B  No. 9 ; pp. 2728-2738
Type of Manuscript:  PAPER
Category: Antennas and Propagation
automotive radarsmillimeter-wave45-degree inclined linear polarizationmicrostrip array antennahigh aperture efficiency
 Summary | Full Text:PDF

Millimeter-Wave Wireless-LAN System Employing Compact and Cost-Effective 156 Mbps Transceiver MCMs
Kazuaki TAKAHASHI Suguru FUJITA Hiroyuki YABUKI Masugi INOUE Gang WU 
Publication:   IEICE TRANSACTIONS on Electronics
Publication Date: 2003/08/01
Vol. E86-C  No. 8 ; pp. 1512-1519
Type of Manuscript:  Special Section PAPER (Special Issue on Microwave and Millimeter Wave Technology)
wireless LANmillimeter-wavemulti chip moduleDROMSK
 Summary | Full Text:PDF

Experimental Demonstration of 622 Mbps Millimeter-Wave over Fiber Link for Broadband Fixed Wireless Access System
Yozo SHOJI Hiroyo OGAWA 
Publication:   IEICE TRANSACTIONS on Electronics
Publication Date: 2003/07/01
Vol. E86-C  No. 7 ; pp. 1129-1137
Type of Manuscript:  Special Section PAPER (Special Issue on Recent Progress in Microwave and Millimeter-wave Photonics Technologies)
Category: Photonic Links for Wireless Communications
 Summary | Full Text:PDF

A Low-Cost and Stable Millimeter-Wave Transmission System Using a Transmission-Filter-Less Double-Side-Band Millimeter-Wave Self-Heterodyne Transmission Technique
Publication:   IEICE TRANSACTIONS on Communications
Publication Date: 2003/06/01
Vol. E86-B  No. 6 ; pp. 1884-1892
Type of Manuscript:  PAPER
Category: Communication Devices/Circuits
 Summary | Full Text:PDF

A Beam Switching Slot Array with a 4-Way Butler Matrix Installed in Single Layer Post-Wall Waveguides
Publication:   IEICE TRANSACTIONS on Communications
Publication Date: 2003/05/01
Vol. E86-B  No. 5 ; pp. 1653-1659
Type of Manuscript:  PAPER
Category: Antenna and Propagation
Butler matrixswitching arraybase station antennapost-wall waveguidemillimeter-wave
 Summary | Full Text:PDF

An Ultra-Broad-Band Bridge-Type MMIC Switch Operating up to Millimeter-Wave Bands
Nobuaki IMAI Akira MINAKAWA 
Publication:   IEICE TRANSACTIONS on Fundamentals of Electronics, Communications and Computer Sciences
Publication Date: 2003/02/01
Vol. E86-A  No. 2 ; pp. 268-272
Type of Manuscript:  Special Section PAPER (Special Section on Analog Circuit Techniques and Related Topics)
 Summary | Full Text:PDF

A Study on Millimeter-Wave Radar Cross Section Characteristics for Road Condition Sensing
Publication:   IEICE TRANSACTIONS on Communications
Publication Date: 1998/12/25
Vol. E81-B  No. 12 ; pp. 2559-2566
Type of Manuscript:  PAPER
Category: Electronic and Radio Applications
ITSmillimeter-waveradar cross sectionrough surfacesensing
 Summary | Full Text:PDF

Low-Noise Superconducting Receivers for Millimeter and Submillimeter Wavelengths
Sheng-Cai SHI Takashi NOGUCHI 
Publication:   IEICE TRANSACTIONS on Electronics
Publication Date: 1998/10/25
Vol. E81-C  No. 10 ; pp. 1584-1594
Type of Manuscript:  INVITED PAPER (Special Issue on Low- and High-Temperature Superconductive Electron Devices and Their Applications)
Category: Analog Applications
SIS mixerHEB mixerdetectorsuperconductingmillimeter-wavesubmillimeter-wave
 Summary | Full Text:PDF

Wide-Band Subharmonically Injection-Locked Oscillators Using Three-Dimensional MMIC Technology
Publication:   IEICE TRANSACTIONS on Electronics
Publication Date: 1998/06/25
Vol. E81-C  No. 6 ; pp. 848-855
Type of Manuscript:  Special Section PAPER (Special Issue on Microwave and Millimeter-Wave Module Technology)
Category: Functional Modules and the Design Technology
frequency synthesizerinjection-locked oscillatormillimeter-waveMMICmasterslicethree-dimensional
 Summary | Full Text:PDF

Reflection Characteristics Measurement from a Truck and a Passenger Car at 60 GHz Frequency Band
Publication:   IEICE TRANSACTIONS on Electronics
Publication Date: 1998/06/25
Vol. E81-C  No. 6 ; pp. 948-952
Type of Manuscript:  Special Section LETTER (Special Issue on Microwave and Millimeter-Wave Module Technology)
RCSradarmillimeter-waveCollision Warning System
 Summary | Full Text:PDF

High Frequency Flip-Chip Bonding Technologies and Their Application to Microwave/Millimeter-Wave ICs
Hiroyuki SAKAI Takayuki YOSHIDA Morikazu SAGAWA 
Publication:   IEICE TRANSACTIONS on Electronics
Publication Date: 1998/06/25
Vol. E81-C  No. 6 ; pp. 810-818
Type of Manuscript:  INVITED PAPER (Special Issue on Microwave and Millimeter-Wave Module Technology)
Category: Functional Modules and the Design Technology
flip-chipbumpHIC (Hybrid IC)microwavemillimeter-wave
 Summary | Full Text:PDF

Development of K-Band Front-End Devices for Broadband Wireless Communication Systems Using Millimeter-Wave Flip-Chip IC Technology
Kazuaki TAKAHASHI Suguru FUJITA Hiroyuki YABUKI Takayuki YOSHIDA Yoshito IKEDA Hiroyuki SAKAI Morikazu SAGAWA 
Publication:   IEICE TRANSACTIONS on Electronics
Publication Date: 1998/06/25
Vol. E81-C  No. 6 ; pp. 827-833
Type of Manuscript:  Special Section PAPER (Special Issue on Microwave and Millimeter-Wave Module Technology)
Category: Functional Modules and the Design Technology
flip-chipmicro bump bondingmillimeter-waveHFETHBT
 Summary | Full Text:PDF

Millimeter- and Submillimeter-Wave Phase-Locking in High-Tc Josephson Junction Arrays
Publication:   IEICE TRANSACTIONS on Electronics
Publication Date: 1997/10/25
Vol. E80-C  No. 10 ; pp. 1275-1281
Type of Manuscript:  Special Section PAPER (Special Issue on Basic Properties and Applications of Superconductive Electron Devices)
Josephson junction arrayhigh Tc superconductorbicrystal substratemillimeter-wavesubmillimeter-wavephaselocking
 Summary | Full Text:PDF

High-Speed Data Transmission Using Millimeter-Wave Fiber-Optic Links
Hiroshi KAWAMURA Nobuaki IMAI Eiichi OGAWA Hideyuki INOMATA 
Publication:   IEICE TRANSACTIONS on Communications
Publication Date: 1996/12/25
Vol. E79-B  No. 12 ; pp. 1784-1791
Type of Manuscript:  Special Section PAPER (Special Issue on Millimeter-wave Short-range Application Systems Technology)
millimeter-wavefiberhigh-speed100 Mbpsmicrocell
 Summary | Full Text:PDF

30-GHz Multibeam Antenna Using Bi-Layer Butler Matrix Circuits
Tomohiro SEKI Kazuhiro UEHARA Kenichi KAGOSHIMA 
Publication:   IEICE TRANSACTIONS on Communications
Publication Date: 1996/12/25
Vol. E79-B  No. 12 ; pp. 1778-1783
Type of Manuscript:  Special Section PAPER (Special Issue on Millimeter-wave Short-range Application Systems Technology)
multibeam antennaButler matrixmillimeter-waveslot-coupled hybridbi-layer
 Summary | Full Text:PDF

Research and Development Trends of Millimeter-wave Short-range Application Systems
Publication:   IEICE TRANSACTIONS on Communications
Publication Date: 1996/12/25
Vol. E79-B  No. 12 ; pp. 1741-1753
Type of Manuscript:  INVITED PAPER (Special Issue on Millimeter-wave Short-range Application Systems Technology)
millimeter-waveshort-range applicationcommunicationssensing
 Summary | Full Text:PDF

Flat and Lateral High-Tc Superconducting Junctions Applied to Millimeter-Wave Mixer
Katsumi SUZUKI Seiichi TOKUNAGA Masahito BAN Masashi OHTSUKA Youichi ENOMOTO 
Publication:   IEICE TRANSACTIONS on Electronics
Publication Date: 1996/09/25
Vol. E79-C  No. 9 ; pp. 1233-1236
Type of Manuscript:  INVITED PAPER (Special Issue on Toward Digital and Analog Applications of Superconductors)
Category: Analog applications
 Summary | Full Text:PDF

A Q-Band High Gain, Low Noise Variable Gain Amplifier Using Dual Gate AlGaAs/InGaAs Pseudomorphic HEMTs
Takuo KASHIWA Takayuki KATOH Naohito YOSHIDA Hiroyuki MINAMI Toshiaki KITANO Makio KOMARU Noriyuki TANINO Tadashi TAKAGI Osamu ISHIHARA 
Publication:   IEICE TRANSACTIONS on Electronics
Publication Date: 1996/04/25
Vol. E79-C  No. 4 ; pp. 573-579
Type of Manuscript:  PAPER
Category: Semiconductor Materials and Devices
millimeter-wavelow noise figureMMICdual gategain control
 Summary | Full Text:PDF

Millimeter-Wave Monolithic AlGaAs/InGaAs/GaAs Pseudomorphic HEMT Low Noise Amplifier Modules for Advanced Microwave Scanning Radiometer
Kazuhiko NAKAHARA Yasushi ITOH Yoshie HORIIE Takeshi SAKURA Naohito YOSHIDA Takayuki KATOH Tadashi TAKAGI Yasuo MITSUI Yasuyuki ITO 
Publication:   IEICE TRANSACTIONS on Electronics
Publication Date: 1995/09/25
Vol. E78-C  No. 9 ; pp. 1210-1215
Type of Manuscript:  Special Section PAPER (Special Issue on Ultra-High-Speed Electron Devices)
amplifierlow noiseMMICmillimeter-waveHEMT
 Summary | Full Text:PDF

60-GHz HEMT-Based MMIC One-Chip Receiver
Tamio SAITO Norio HIDAKA Yoji OHASHI Kazuo SHIRAKAWA Yoshihiro KAWASAKI Toshihiro SHIMURA Hideyuki OIKAWA Yoshio AOKI 
Publication:   IEICE TRANSACTIONS on Electronics
Publication Date: 1995/09/25
Vol. E78-C  No. 9 ; pp. 1216-1222
Type of Manuscript:  Special Section PAPER (Special Issue on Ultra-High-Speed Electron Devices)
 Summary | Full Text:PDF

Millimeter Wave Propagation Model and Delay Spread along the Maglev Guideway
Publication:   IEICE TRANSACTIONS on Communications
Publication Date: 1995/08/25
Vol. E78-B  No. 8 ; pp. 1204-1207
Type of Manuscript:  Special Section LETTER (Special Issue on Technologies for High-Speed Mobile Communications)
mobile communicationmillimeter-wavepropagation modeldelay spreadcoherence bandwidth
 Summary | Full Text:PDF

A Novel Millimeter-Wave IC on Si Substrate Using Flip-Chip Bonding Technology
Hiroyuki SAKAI Yorito OTA Kaoru INOUE Takayuki YOSHIDA Kazuaki TAKAHASHI Suguru FUJITA Morikazu SAGAWA 
Publication:   IEICE TRANSACTIONS on Electronics
Publication Date: 1995/08/25
Vol. E78-C  No. 8 ; pp. 971-978
Type of Manuscript:  Special Section PAPER (Special Issue on Microwave and Millimeter-Wave Technology)
millimeter-waveflip-chipIC (Integrated Circuit)microstrip linebump
 Summary | Full Text:PDF

An Ultra Low Noise 50-GHz-Band Amplifier MMIC Using an AIGaAs/InGaAs Pseudomorphic HEMT
Takuo KASHIWA Takayuki KATOH Naohito YOSHIDA Hiroyuki MINAMI Toshiaki KITANO Makio KOMARU Noriyuki TANINO 
Publication:   IEICE TRANSACTIONS on Electronics
Publication Date: 1995/03/25
Vol. E78-C  No. 3 ; pp. 318-321
Type of Manuscript:  LETTER
Category: Electromagnetic Theory
millimeter-wavelow noise figureMMICAlGaAs/InGaAs Pseudomorphic HEMTmodeling
 Summary | Full Text:PDF

Applicability of Specific Rain Attenuation Models at Millimeter Wavelengths
Toshio IHARA 
Publication:   IEICE TRANSACTIONS on Communications
Publication Date: 1994/10/25
Vol. E77-B  No. 10 ; pp. 1275-1278
Type of Manuscript:  LETTER
Category: Antennas and Propagation
millimeter-wavespecific rain attenuationdropsize distribution
 Summary | Full Text:PDF

Characterization of Inverted Slot Line for Travelling Wave Optical Modulator
Publication:   IEICE TRANSACTIONS on Electronics
Publication Date: 1993/02/25
Vol. E76-C  No. 2 ; pp. 229-237
Type of Manuscript:  Special Section PAPER (Special Issue on Optical/Microwave Interaction Devices, Circuits and Systems)
Category: Optical/Microwave Devices
optical modulatorinverted slot linespectral domain techniquemillimeter-wavetransmissionLiNbO3 substrate
 Summary | Full Text:PDF

A Millimeter-Wave Monolithic High Power Amplifier Using a Novel Tandem FET
Publication:   IEICE TRANSACTIONS on Electronics
Publication Date: 1992/06/25
Vol. E75-C  No. 6 ; pp. 669-673
Type of Manuscript:  Special Section PAPER (Special Issue on MMIC Technology)
millimeter-wavehigh power amplifierMMICtandem FET
 Summary | Full Text:PDF

High-Power Millimeter Wave MMIC Amplifier Design Using Improved Load-Pull Method
Kazuo NAGATOMO Shoichi KOIKE Naofumi OKUBO Masafumi SHIGAKI 
Publication:   IEICE TRANSACTIONS on Electronics
Publication Date: 1992/06/25
Vol. E75-C  No. 6 ; pp. 663-668
Type of Manuscript:  Special Section PAPER (Special Issue on MMIC Technology)
MMIClarge-signalhigh-power amplifier load-pullmillimeter-wave
 Summary | Full Text:PDF